Lineage for d1e97a_ (1e97 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131584Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 131706Superfamily d.17.4: NTF2-like [54427] (4 families) (S)
  5. 131750Family d.17.4.3: Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54434] (1 protein)
  6. 131751Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 131764Species Pseudomonas putida [TaxId:303] [54437] (11 PDB entries)
  8. 131773Domain d1e97a_: 1e97 A: [64803]

Details for d1e97a_

PDB Entry: 1e97 (more details), 2 Å

PDB Description: crystal structure of ketosteroid isomerase from pseudomonas putida ; triple mutant y16f/y32f/y57f

SCOP Domain Sequences for d1e97a_:

Sequence, based on SEQRES records: (download)

>d1e97a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmarfielvdvgdieaivqmfaddatvedpfgqppihgreqiaaffrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d1e97a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida}
nlptaqevqglmarfielvdvgdieaivqmfaddatvedpfgqppihgreqiaaffrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOP Domain Coordinates for d1e97a_:

Click to download the PDB-style file with coordinates for d1e97a_.
(The format of our PDB-style files is described here.)

Timeline for d1e97a_: