Lineage for d1e93a_ (1e93 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2245760Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2245761Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2245762Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2245763Protein Catalase I [56636] (8 species)
  7. 2245834Species Proteus mirabilis [TaxId:584] [56640] (11 PDB entries)
  8. 2245835Domain d1e93a_: 1e93 A: [64802]
    complexed with act, hem, so4

Details for d1e93a_

PDB Entry: 1e93 (more details), 2 Å

PDB Description: high resolution structure and biochemical properties of a recombinant catalase depleted in iron
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d1e93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]}
kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
lfeaikrgdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle

SCOPe Domain Coordinates for d1e93a_:

Click to download the PDB-style file with coordinates for d1e93a_.
(The format of our PDB-style files is described here.)

Timeline for d1e93a_: