Lineage for d1e93a_ (1e93 A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200302Fold e.5: Heme-linked catalases [56633] (1 superfamily)
  4. 200303Superfamily e.5.1: Heme-linked catalases [56634] (1 family) (S)
  5. 200304Family e.5.1.1: Heme-linked catalases [56635] (2 proteins)
  6. 200305Protein Catalase I [56636] (6 species)
  7. 200349Species Proteus mirabilis [TaxId:584] [56640] (5 PDB entries)
  8. 200350Domain d1e93a_: 1e93 A: [64802]

Details for d1e93a_

PDB Entry: 1e93 (more details), 2 Å

PDB Description: high resolution structure and biochemical properties of a recombinant catalase depleted in iron

SCOP Domain Sequences for d1e93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis}
kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
lfeaikrgdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle

SCOP Domain Coordinates for d1e93a_:

Click to download the PDB-style file with coordinates for d1e93a_.
(The format of our PDB-style files is described here.)

Timeline for d1e93a_: