Lineage for d1e92c_ (1e92 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841754Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species)
  7. 2841757Species Leishmania major [TaxId:5664] [63926] (14 PDB entries)
    Uniprot Q01782
  8. 2841773Domain d1e92c_: 1e92 C: [64800]
    complexed with edo, hbi, nap

Details for d1e92c_

PDB Entry: 1e92 (more details), 2.2 Å

PDB Description: pteridine reductase 1 from leishmania major complexed with nadp+ and dihydrobiopterin
PDB Compounds: (C:) pteridine reductase 1

SCOPe Domain Sequences for d1e92c_:

Sequence, based on SEQRES records: (download)

>d1e92c_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedg
hepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtn
qpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskv
plyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1e92c_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndreametatad
lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
gltrsaalelaplqirvngvgpglsvlvghrskvplyqrdssaaevsdvviflcsskaky
itgtcvkvdggysltra

SCOPe Domain Coordinates for d1e92c_:

Click to download the PDB-style file with coordinates for d1e92c_.
(The format of our PDB-style files is described here.)

Timeline for d1e92c_: