Lineage for d1e92b_ (1e92 B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238382Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (31 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 238491Protein Dihydropteridin reductase (pteridine reductase) [51769] (3 species)
  7. 238494Species Leishmania major [TaxId:5664] [63926] (2 PDB entries)
  8. 238498Domain d1e92b_: 1e92 B: [64799]

Details for d1e92b_

PDB Entry: 1e92 (more details), 2.2 Å

PDB Description: pteridine reductase 1 from leishmania major complexed with nadp+ and dihydrobiopterin

SCOP Domain Sequences for d1e92b_:

Sequence, based on SEQRES records: (download)

>d1e92b_ c.2.1.2 (B:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrnded
ghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamt
nqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrsk
vplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1e92b_ c.2.1.2 (B:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
dlsnvatapsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatad
lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
gltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvi
flcsskakyitgtcvkvdggysltra

SCOP Domain Coordinates for d1e92b_:

Click to download the PDB-style file with coordinates for d1e92b_.
(The format of our PDB-style files is described here.)

Timeline for d1e92b_: