Lineage for d1e92a_ (1e92 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118103Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (27 proteins)
  6. 118200Protein Dihydropteridin reductase (pteridine reductase) [51769] (3 species)
  7. 118203Species Leishmania major [TaxId:5664] [63926] (2 PDB entries)
  8. 118206Domain d1e92a_: 1e92 A: [64798]

Details for d1e92a_

PDB Entry: 1e92 (more details), 2.2 Å

PDB Description: pteridine reductase 1 from leishmania major complexed with nadp+ and dihydrobiopterin

SCOP Domain Sequences for d1e92a_:

Sequence, based on SEQRES records: (download)

>d1e92a_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndedg
hepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtn
qpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweghrskv
plyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra

Sequence, based on observed residues (ATOM records): (download)

>d1e92a_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major}
vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrndgdreametat
adlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakga
legltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdv
viflcsskakyitgtcvkvdggysltra

SCOP Domain Coordinates for d1e92a_:

Click to download the PDB-style file with coordinates for d1e92a_.
(The format of our PDB-style files is described here.)

Timeline for d1e92a_: