| Class b: All beta proteins [48724] (126 folds) |
| Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) |
| Protein Cyclophilin (eukaryotic) [50893] (8 species) |
| Species Caenorhabditis elegans, isoform 3 [TaxId:6239] [50899] (3 PDB entries) |
| Domain d1e8ka_: 1e8k A: [64797] complexed with ala, pro |
PDB Entry: 1e8k (more details), 1.9 Å
SCOP Domain Sequences for d1e8ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8ka_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk
Timeline for d1e8ka_: