Lineage for d1e8ja_ (1e8j A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 144953Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 144954Family g.41.5.1: Rubredoxin [57803] (2 proteins)
  6. 144955Protein Rubredoxin [57804] (6 species)
  7. 144982Species Desulfovibrio gigas [TaxId:879] [57806] (2 PDB entries)
  8. 144984Domain d1e8ja_: 1e8j A: [64796]

Details for d1e8ja_

PDB Entry: 1e8j (more details)

PDB Description: solution structure of desulfovibrio gigas zinc rubredoxin, nmr, 20 structures

SCOP Domain Sequences for d1e8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ja_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio gigas}
mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq

SCOP Domain Coordinates for d1e8ja_:

Click to download the PDB-style file with coordinates for d1e8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1e8ja_: