SCOPe 2.06: Domain d1e8ea_: 1e8e A:

Lineage for d1e8ea_ (1e8e A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c'' [68950] (1 species)
   close homologue of SHP

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [68951] (3 PDB entries)

8. Domain d1e8ea_: 1e8e A: [64795]
   complexed with hec

Details for d1e8ea_

PDB Entry: 1e8e

PDB Description: solution structure of methylophilus methylotrophus cytochrome c''. insights into the structural basis of haem-ligand detachment

PDB Compounds: (A:) cytochrome c''

SCOPe Domain Sequences for d1e8ea_:

Sequence; same for both SEQRES and ATOM records:

>d1e8ea_ a.3.1.1 (A:) Cytochrome c'' {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
kptk

Timeline for d1e8ea_:

• d1e8ea_ first appeared in SCOP 1.59
  
• d1e8ea_ appears in SCOPe 2.05
  
• d1e8ea_ appears in SCOPe 2.07
  
• d1e8ea_ appears in the current release, SCOPe 2.08