Lineage for d1dnw.2 (1dnw B:,D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99790Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 99791Protein Myeloperoxidase [48133] (2 species)
  7. 99795Species Human (Homo sapiens) [TaxId:9606] [48134] (7 PDB entries)
  8. 99803Domain d1dnw.2: 1dnw B:,D: [64791]

Details for d1dnw.2

PDB Entry: 1dnw (more details), 1.9 Å

PDB Description: human myeloperoxidase-cyanide-thiocyanate complex

SCOP Domain Sequences for d1dnw.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dnw.2 a.93.1.2 (B:,D:) Myeloperoxidase {Human (Homo sapiens)}
cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaXvncetscvqqppcfp
lkippndpriknqadcipffrscpacpgsnitirnqinaltsfvdasmvygseeplarnl
rnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripcflagdtrssempelt
smhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiityrdylplvlgptamr
kylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqpmepnprvplsrvffa
swrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmrigldlpalnmqrsrd
hglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpnnidiwmggvseplkr
kgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqislpriicdntgittvs
knnifmsnsyprdfvncstlpalnlaswrea

SCOP Domain Coordinates for d1dnw.2:

Click to download the PDB-style file with coordinates for d1dnw.2.
(The format of our PDB-style files is described here.)

Timeline for d1dnw.2: