Lineage for d1dnu.2 (1dnu B:,D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002844Protein Myeloperoxidase [48133] (2 species)
  7. 2002848Species Human (Homo sapiens) [TaxId:9606] [48134] (7 PDB entries)
  8. 2002850Domain d1dnu.2: 1dnu B:,D: [64789]
    complexed with acy, ca, hem, nag, scn, so4

Details for d1dnu.2

PDB Entry: 1dnu (more details), 1.85 Å

PDB Description: structural analyses of human myeloperoxidase-thiocyanate complex
PDB Compounds: (B:) myeloperoxidase, (D:) myeloperoxidase

SCOPe Domain Sequences for d1dnu.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dnu.2 a.93.1.2 (B:,D:) Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606]}
cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaXvncetscvqqppcfp
lkippndpriknqadcipffrscpacpgsnitirnqinaltsfvdasmvygseeplarnl
rnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripcflagdtrssempelt
smhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiityrdylplvlgptamr
kylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqpmepnprvplsrvffa
swrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmrigldlpalnmqrsrd
hglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpnnidiwmggvseplkr
kgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqislpriicdntgittvs
knnifmsnsyprdfvncstlpalnlaswrea

SCOPe Domain Coordinates for d1dnu.2:

Click to download the PDB-style file with coordinates for d1dnu.2.
(The format of our PDB-style files is described here.)

Timeline for d1dnu.2: