Lineage for d1d7w.2 (1d7w B:,D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins)
  6. Protein Myeloperoxidase [48133] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48134] (7 PDB entries)
  8. Domain d1d7w.2: 1d7w B:,D: [64777]
    complexed with act, br, ca, cyn, hem, nag, so4

Details for d1d7w.2

PDB Entry: 1d7w (more details), 1.9 Å

PDB Description: crystal structure of human myeloperoxidase isoform c complexed with cyanide and bromide at ph 4.0
PDB Compounds: (B:) myeloperoxidase, (D:) myeloperoxidase

SCOPe Domain Sequences for d1d7w.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1d7w.2 a.93.1.2 (B:,D:) Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606]}
cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaXvncetscvqqppcfp
lkippndpriknqadcipffrscpacpgsnitirnqinaltsfvdasmvygseeplarnl
rnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripcflagdtrssempelt
smhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiityrdylplvlgptamr
kylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqpmepnprvplsrvffa
swrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmrigldlpalnmqrsrd
hglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpnnidiwmggvseplkr
kgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqislpriicdntgittvs
knnifmsnsyprdfvncstlpalnlaswrea

SCOPe Domain Coordinates for d1d7w.2 are not available.

Timeline for d1d7w.2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d7w.1, d1d7w.1, d1d7w.1, d1d7w.1