Class b: All beta proteins [48724] (119 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (3 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins) barrel, closed; n=8, S=12, meander |
Protein Nitrophorin 4 [50845] (1 species) |
Species Rhodnius prolixus [TaxId:13249] [50846] (9 PDB entries) |
Domain d1d2ua_: 1d2u A: [64773] complexed with hem, nh3 |
PDB Entry: 1d2u (more details), 1.15 Å
SCOP Domain Sequences for d1d2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ua_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus} actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks lltk
Timeline for d1d2ua_: