Lineage for d1d2ua_ (1d2u A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169857Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 169858Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 169859Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
  6. 169954Protein Nitrophorin 4 [50845] (1 species)
  7. 169955Species Rhodnius prolixus [TaxId:13249] [50846] (8 PDB entries)
  8. 169957Domain d1d2ua_: 1d2u A: [64773]

Details for d1d2ua_

PDB Entry: 1d2u (more details), 1.15 Å

PDB Description: 1.15 a crystal structure of nitrophorin 4 from rhodnius prolixus

SCOP Domain Sequences for d1d2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ua_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOP Domain Coordinates for d1d2ua_:

Click to download the PDB-style file with coordinates for d1d2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ua_: