Lineage for d1d2ua_ (1d2u A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (14 proteins) Protein Nitrophorin 4 [50845] (1 species) Species Rhodnius prolixus [TaxId:13249] [50846] (8 PDB entries) 
Domain d1d2ua_: 1d2u A: [64773]
Details for d1d2ua_
PDB Entry: 1d2u (more details), 1.15 Å
PDB Description: 1.15 a crystal structure of nitrophorin 4 from rhodnius prolixus
SCOP Domain Sequences for d1d2ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ua_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk
SCOP Domain Coordinates for d1d2ua_:
Click to download the PDB-style file with coordinates for d1d2ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d2ua_:
- d1d2ua_ is new in SCOP 1.59
- d1d2ua_ appears in SCOP 1.61
- d1d2ua_ appears in the current release, SCOPe 2.08
View in 3D