SCOPe 2.05: Domain d1d0ca_: 1d0c A:

Lineage for d1d0ca_ (1d0c A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (85 PDB entries)
   Uniprot P29473 67-482

8. Domain d1d0ca_: 1d0c A: [64769]
   complexed with act, cad, gol, hem, ine, zn

Details for d1d0ca_

PDB Entry: 1d0c, 1.65 Å

PDB Description: bovine endothelial nitric oxide synthase heme domain complexed with 3-bromo-7-nitroindazole (h4b free)

PDB Compounds: (A:) bovine endothelial nitric oxide synthase heme domain

SCOPe Domain Sequences for d1d0ca_:

Sequence; same for both SEQRES and ATOM records:

>d1d0ca_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]}
gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll
sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc
vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw
nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv
lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt
rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat
vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d1d0ca_:

• d1d0ca_ first appeared in SCOP 1.59
  
• d1d0ca_ appears in SCOPe 2.04
  
• d1d0ca_ appears in SCOPe 2.06
  
• d1d0ca_ appears in the current release, SCOPe 2.08