Lineage for d1ci9a_ (1ci9 A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200057Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 200058Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 200059Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 200263Protein Esterase EstB [69873] (1 species)
  7. 200264Species Burkholderia gladioli [TaxId:28095] [69874] (2 PDB entries)
  8. 200265Domain d1ci9a_: 1ci9 A: [64767]

Details for d1ci9a_

PDB Entry: 1ci9 (more details), 1.8 Å

PDB Description: dfp-inhibited esterase estb from burkholderia gladioli

SCOP Domain Sequences for d1ci9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli}
aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
egmsgpltialrdavya

SCOP Domain Coordinates for d1ci9a_:

Click to download the PDB-style file with coordinates for d1ci9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ci9a_: