Lineage for d1ci9a_ (1ci9 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013465Protein Esterase EstB [69873] (1 species)
  7. 3013466Species Burkholderia gladioli [TaxId:28095] [69874] (2 PDB entries)
  8. 3013467Domain d1ci9a_: 1ci9 A: [64767]
    complexed with dfp

Details for d1ci9a_

PDB Entry: 1ci9 (more details), 1.8 Å

PDB Description: dfp-inhibited esterase estb from burkholderia gladioli
PDB Compounds: (A:) protein (carboxylesterase)

SCOPe Domain Sequences for d1ci9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]}
aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
egmsgpltialrdavya

SCOPe Domain Coordinates for d1ci9a_:

Click to download the PDB-style file with coordinates for d1ci9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ci9a_: