Lineage for d1ci8a_ (1ci8 A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569179Protein Esterase EstB [69873] (1 species)
  7. 2569180Species Burkholderia gladioli [TaxId:28095] [69874] (2 PDB entries)
  8. 2569183Domain d1ci8a_: 1ci8 A: [64765]
    complexed with ipa

Details for d1ci8a_

PDB Entry: 1ci8 (more details), 2 Å

PDB Description: esterase estb from burkholderia gladioli: an esterase with (beta)- lactamase fold.
PDB Compounds: (A:) protein (carboxylesterase)

SCOPe Domain Sequences for d1ci8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ci8a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]}
aaslaarldavfdqalrerrlvgavaivarhgeilyrraqgladreagrpmredtlfrla
svtkpivalavlrlvargelaldapvtrwlpefrprladgseplvtihhllthtsglgyw
llegagsvydrlgisdgidlrdfdldenlrrlasaplsfapgsgwqyslaldvlgavver
atgqplaaavdalvaqplgmrdcgfvsaeperfavpyhdgqpepvrmrdgievplpeghg
aavrfapsrvfepgaypsggagmygsaddvlraleairanpgflpetladaarrdqagvg
aetrgpgwgfgylsavlddpaaagtpqhagtlqwggvyghswfvdralglsvllltntay
egmsgpltialrdavya

SCOPe Domain Coordinates for d1ci8a_:

Click to download the PDB-style file with coordinates for d1ci8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ci8a_: