Lineage for d1c54a_ (1c54 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. Protein RNase Sa [53935] (1 species)
  7. Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
    Uniprot P05798
  8. Domain d1c54a_: 1c54 A: [64764]

Details for d1c54a_

PDB Entry: 1c54 (more details)

PDB Description: solution structure of ribonuclease sa
PDB Compounds: (A:) ribonuclease sa

SCOPe Domain Sequences for d1c54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c54a_ d.1.1.2 (A:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOPe Domain Coordinates for d1c54a_ are not available.

Timeline for d1c54a_: