| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
| Family a.4.1.5: Paired domain [46748] (3 proteins) duplication: consists of two domains of this fold |
| Protein Pax-6 [68936] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46750] (1 PDB entry) |
| Domain d6paxa2: 6pax A:69-133 [64759] |
PDB Entry: 6pax (more details), 2.5 Å
SCOP Domain Sequences for d6paxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens)}
ggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssinrvlrnla
sekqq
Timeline for d6paxa2: