SCOP 1.73: Domain d2a8vc2: 2a8v C:48-118

Lineage for d2a8vc2 (2a8v C:48-118)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)

7. Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)

8. Domain d2a8vc2: 2a8v C:48-118 [64757]
   Other proteins in same PDB: d2a8va1, d2a8vb1, d2a8vc1
   protein/RNA complex

Details for d2a8vc2

PDB Entry: 2a8v, 2.4 Å

PDB Description: rho transcription termination factor/rna complex

PDB Compounds: (C:) RNA binding domain of rho transcription termination factor

SCOP Domain Sequences for d2a8vc2:

Sequence; same for both SEQRES and ATOM records:

>d2a8vc2 b.40.4.5 (C:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

Timeline for d2a8vc2:

• d2a8vc2 first appeared in SCOP 1.59
  
• d2a8vc2 appears in SCOP 1.71
  
• d2a8vc2 appears in SCOP 1.75
  
• d2a8vc2 appears in the current release, SCOPe 2.08