Lineage for d2a8vb1 (2a8v B:1-47)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545076Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 545107Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) (S)
  5. 545108Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
  6. 545109Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 545110Species Escherichia coli [TaxId:562] [50295] (8 PDB entries)
  8. 545115Domain d2a8vb1: 2a8v B:1-47 [64754]
    Other proteins in same PDB: d2a8va2, d2a8vb2, d2a8vc2

Details for d2a8vb1

PDB Entry: 2a8v (more details), 2.4 Å

PDB Description: rho transcription termination factor/rna complex
PDB Compounds: (B:)

SCOP Domain Sequences for d2a8vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8vb1 a.140.3.1 (B:1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOP Domain Coordinates for d2a8vb1:

Click to download the PDB-style file with coordinates for d2a8vb1.
(The format of our PDB-style files is described here.)

Timeline for d2a8vb1: