![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) |
![]() | Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [68926] (6 PDB entries) |
![]() | Domain d1oen_2: 1oen 6-227 [64751] Other proteins in same PDB: d1oen_1 complexed with act |
PDB Entry: 1oen (more details), 1.9 Å
SCOP Domain Sequences for d1oen_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oen_2 c.109.1.1 (6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli} gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg
Timeline for d1oen_2: