Lineage for d1oen_2 (1oen 6-227)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322784Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 322785Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 322786Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 322793Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68925] (3 species)
  7. 322794Species Escherichia coli [TaxId:562] [68926] (5 PDB entries)
  8. 322797Domain d1oen_2: 1oen 6-227 [64751]
    Other proteins in same PDB: d1oen_1
    complexed with act

Details for d1oen_2

PDB Entry: 1oen (more details), 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1oen_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oen_2 c.109.1.1 (6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOP Domain Coordinates for d1oen_2:

Click to download the PDB-style file with coordinates for d1oen_2.
(The format of our PDB-style files is described here.)

Timeline for d1oen_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oen_1