![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [68926] (10 PDB entries) |
![]() | Domain d1oena2: 1oen A:6-227 [64751] Other proteins in same PDB: d1oena1 complexed with act |
PDB Entry: 1oen (more details), 1.9 Å
SCOPe Domain Sequences for d1oena2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oena2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg
Timeline for d1oena2: