SCOPe 2.05: Domain d1jeqa1: 1jeq A:559-609

Lineage for d1jeqa1 (1jeq A:559-609)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.2: SAP domain [68906] (1 family)

5. Family a.140.2.1: SAP domain [68907] (8 proteins)
   Pfam PF02037

6. Protein DNA binding C-terminal domain of ku70 [68908] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries)

8. Domain d1jeqa1: 1jeq A:559-609 [64748]
   Other proteins in same PDB: d1jeqa3, d1jeqa4, d1jeqb1, d1jeqb2

Details for d1jeqa1

PDB Entry: 1jeq, 2.7 Å

PDB Description: crystal structure of the ku heterodimer

PDB Compounds: (A:) Ku70

SCOPe Domain Sequences for d1jeqa1:

Sequence; same for both SEQRES and ATOM records:

>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]}
yseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd

Timeline for d1jeqa1:

• d1jeqa1 first appeared in SCOP 1.59
  
• d1jeqa1 appears in SCOPe 2.04
  
• d1jeqa1 appears in SCOPe 2.06
  
• d1jeqa1 appears in the current release, SCOPe 2.08