Class a: All alpha proteins [46456] (202 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.2: SAP domain [68906] (1 family) |
Family a.140.2.1: SAP domain [68907] (3 proteins) |
Protein DNA binding C-terminal domain of ku70 [68908] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries) |
Domain d1jeqa1: 1jeq A:559-609 [64748] Other proteins in same PDB: d1jeqa3, d1jeqa4, d1jeqb1, d1jeqb2 |
PDB Entry: 1jeq (more details), 2.7 Å
SCOP Domain Sequences for d1jeqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens)} yseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd
Timeline for d1jeqa1: