SCOP 1.71: Domain d1ig8a2: 1ig8 A:225-486

Lineage for d1ig8a2 (1ig8 A:225-486)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Hexokinase [53084] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry)

8. Domain d1ig8a2: 1ig8 A:225-486 [64747]
   complexed with sul

Details for d1ig8a2

PDB Entry: 1ig8, 2.2 Å

PDB Description: Crystal Structure of Yeast Hexokinase PII with the correct amino acid sequence

SCOP Domain Sequences for d1ig8a2:

Sequence; same for both SEQRES and ATOM records:

>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII}
etkmgvifgtgvngayydvcsdieklqgklsddippsapmainceygsfdnehvvlprtk
yditideesprpgqqtfekmssgyylgeilrlalmdmykqgfifknqdlskfdkpfvmdt
syparieedpfenledtddlfqnefginttvqerklirrlseligaraarlsvcgiaaic
qkrgyktghiaadgsvynrypgfkekaanalkdiygwtqtslddypikivpaedgsgaga
aviaalaqkriaegksvgiiga

Timeline for d1ig8a2:

• d1ig8a2 first appeared in SCOP 1.59
  
• d1ig8a2 appears in SCOP 1.69
  
• d1ig8a2 appears in SCOP 1.73
  
• d1ig8a2 appears in the current release, SCOPe 2.08