Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) duplication contains two domains of this fold |
Family c.55.1.3: Hexokinase [53083] (3 proteins) |
Protein Hexokinase [53084] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry) |
Domain d1ig8a1: 1ig8 A:18-224 [64746] |
PDB Entry: 1ig8 (more details), 2.2 Å
SCOP Domain Sequences for d1ig8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} dvpkelmqqienfekiftvptetlqavtkhfiselekglskkggnipmipgwvmdfptgk esgdflaidlggtnlrvvlvklggdrtfdttqskyrlpdamrttqnpdelwefiadslka fideqfpqgisepiplgftfsfpasqnkinegilqrwtkgfdipnienhdvvpmlqkqit krnipievvalindttgtlvasyytdp
Timeline for d1ig8a1: