SCOP 1.69: Domain d1ig8a1: 1ig8 A:18-224

Lineage for d1ig8a1 (1ig8 A:18-224)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Hexokinase [53084] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry)

8. Domain d1ig8a1: 1ig8 A:18-224 [64746]

Details for d1ig8a1

PDB Entry: 1ig8, 2.2 Å

PDB Description: Crystal Structure of Yeast Hexokinase PII with the correct amino acid sequence

SCOP Domain Sequences for d1ig8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII}
dvpkelmqqienfekiftvptetlqavtkhfiselekglskkggnipmipgwvmdfptgk
esgdflaidlggtnlrvvlvklggdrtfdttqskyrlpdamrttqnpdelwefiadslka
fideqfpqgisepiplgftfsfpasqnkinegilqrwtkgfdipnienhdvvpmlqkqit
krnipievvalindttgtlvasyytdp

Timeline for d1ig8a1:

• d1ig8a1 first appeared in SCOP 1.59
  
• d1ig8a1 appears in SCOP 1.67
  
• d1ig8a1 appears in SCOP 1.71
  
• d1ig8a1 appears in the current release, SCOPe 2.08