Lineage for d1fc6a3 (1fc6 A:157-248)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786385Family b.36.1.3: Tail specific protease PDZ domain [68933] (2 proteins)
  6. 2786386Protein Photosystem II D1 C-terminal processing protease [68934] (1 species)
  7. 2786387Species Algae (Scenedesmus obliquus) [TaxId:3088] [50171] (4 PDB entries)
  8. 2786388Domain d1fc6a3: 1fc6 A:157-248 [64738]
    Other proteins in same PDB: d1fc6a4

Details for d1fc6a3

PDB Entry: 1fc6 (more details), 1.8 Å

PDB Description: photosystem ii d1 c-terminal processing protease
PDB Compounds: (A:) photosystem II d1 protease

SCOPe Domain Sequences for d1fc6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]}
agsvtgvgleitydggsgkdvvvltpapggpaekagaragdvivtvdgtavkgmslydvs
dllqgeadsqvevvlhapgapsntrtlqltrq

SCOPe Domain Coordinates for d1fc6a3:

Click to download the PDB-style file with coordinates for d1fc6a3.
(The format of our PDB-style files is described here.)

Timeline for d1fc6a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fc6a4