Lineage for d1efma1 (1efm A:12-190)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110458Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2110465Species Escherichia coli [TaxId:562] [52627] (10 PDB entries)
    Uniprot P02990
  8. 2110478Domain d1efma1: 1efm A:12-190 [64732]
    one domain only
    complexed with gdp, mg

Details for d1efma1

PDB Entry: 1efm (more details), 2.7 Å

PDB Description: structure of the gdp domain of ef-tu and location of the amino acids homologous to ras oncogene proteins
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1efma1:

Sequence, based on SEQRES records: (download)

>d1efma1 c.37.1.8 (A:12-190) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
vnvgtighvdhgkttltaaittvlaktyggaargitintshveydtptrhyahvdcpgha
dyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeel
lelvemevrellsqydfpgddtpivrgsalkalegdaeweakile

Sequence, based on observed residues (ATOM records): (download)

>d1efma1 c.37.1.8 (A:12-190) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
vnvgtighvdhgkttltaaittvlaktytintshveydtptrhyahvdcpghadyvknmi
tgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelveme
vrellsqydfpgddtpivrgsalkalegdaeweakile

SCOPe Domain Coordinates for d1efma1:

Click to download the PDB-style file with coordinates for d1efma1.
(The format of our PDB-style files is described here.)

Timeline for d1efma1: