Lineage for d1e7lb2 (1e7l B:1-103)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. Family d.4.1.5: Recombination endonuclease VII, N-terminal domain [68915] (1 protein)
  6. Protein Recombination endonuclease VII, N-terminal domain [68916] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [68917] (5 PDB entries)
  8. Domain d1e7lb2: 1e7l B:1-103 [64731]
    Other proteins in same PDB: d1e7la1, d1e7lb1
    complexed with so4, zn; mutant

Details for d1e7lb2

PDB Entry: 1e7l (more details), 1.32 Å

PDB Description: endonuclease vii (endovii) n62d mutant from phage t4
PDB Compounds: (B:) recombination endonuclease vii

SCOPe Domain Sequences for d1e7lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7lb2 d.4.1.5 (B:1-103) Recombination endonuclease VII, N-terminal domain {Bacteriophage T4 [TaxId: 10665]}
mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
cdaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnn

SCOPe Domain Coordinates for d1e7lb2 are not available.

Timeline for d1e7lb2:

Domains from same chain:
(mouse over for more information)
d1e7lb1
Domains from other chains:
(mouse over for more information)
d1e7la1, d1e7la2