Class a: All alpha proteins [46456] (290 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.4: Recombination endonuclease VII, C-terminal and dimerization domains [68918] (1 family) automatically mapped to Pfam PF09124 |
Family a.140.4.1: Recombination endonuclease VII, C-terminal and dimerization domains [68919] (1 protein) |
Protein Recombination endonuclease VII, C-terminal and dimerization domains [68920] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [54074] (5 PDB entries) |
Domain d1e7lb1: 1e7l B:104-157 [64730] Other proteins in same PDB: d1e7la2, d1e7lb2 complexed with so4, zn; mutant |
PDB Entry: 1e7l (more details), 1.32 Å
SCOPe Domain Sequences for d1e7lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e7lb1 a.140.4.1 (B:104-157) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4 [TaxId: 10665]} ihpnfvgdkskefsrlgkeemmaemlqrgfeynesdtktqliasfkkqlrkslk
Timeline for d1e7lb1: