Lineage for d1dl5b2 (1dl5 B:214-316)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199657Fold d.197: Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68929] (1 superfamily)
  4. 199658Superfamily d.197.1: Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68930] (1 family) (S)
  5. 199659Family d.197.1.1: Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68931] (1 protein)
  6. 199660Protein Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68932] (1 species)
  7. 199661Species Thermotoga maritima [TaxId:243274] [53356] (1 PDB entry)
  8. 199663Domain d1dl5b2: 1dl5 B:214-316 [64723]
    Other proteins in same PDB: d1dl5a1, d1dl5b1

Details for d1dl5b2

PDB Entry: 1dl5 (more details), 1.8 Å

PDB Description: protein-l-isoaspartate o-methyltransferase

SCOP Domain Sequences for d1dl5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl5b2 d.197.1.1 (B:214-316) Protein-L-isoaspartyl O-methyltransferase, C-terminal domain {Thermotoga maritima}
nllernrkllrefpfnreillvrshifvelvdlltrrlteidgtfyyagpngvveflddr
mriygdapeienlltqwescgyrsfeylmlhvgynafshiscs

SCOP Domain Coordinates for d1dl5b2:

Click to download the PDB-style file with coordinates for d1dl5b2.
(The format of our PDB-style files is described here.)

Timeline for d1dl5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dl5b1