SCOP 1.75: Domain d1ayla2: 1ayl A:1-227

Lineage for d1ayla2 (1ayl A:1-227)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)

6. Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)

7. Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)

8. Domain d1ayla2: 1ayl A:1-227 [64719]
   Other proteins in same PDB: d1ayla1
   complexed with atp, mg, oxl

Details for d1ayla2

PDB Entry: 1ayl, 1.8 Å

PDB Description: phosphoenolpyruvate carboxykinase

PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1ayla2:

Sequence; same for both SEQRES and ATOM records:

>d1ayla2 c.109.1.1 (A:1-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

Timeline for d1ayla2:

• d1ayla2 first appeared in SCOP 1.59, called d1ayl_2
  
• d1ayla2 appears in SCOP 1.73
  
• d1ayla2 appears in SCOPe 2.01
  
• d1ayla2 appears in the current release, SCOPe 2.08