Lineage for d1ayla1 (1ayl A:228-540)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143124Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (4 species)
  7. 2143128Species Escherichia coli [TaxId:562] [53798] (10 PDB entries)
  8. 2143130Domain d1ayla1: 1ayl A:228-540 [64718]
    Other proteins in same PDB: d1ayla2
    complexed with atp, mg, oxl

Details for d1ayla1

PDB Entry: 1ayl (more details), 1.8 Å

PDB Description: phosphoenolpyruvate carboxykinase
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1ayla1:

Sequence, based on SEQRES records: (download)

>d1ayla1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

Sequence, based on observed residues (ATOM records): (download)

>d1ayla1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklaptptfsacfgaafls
lhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftl
pmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalva
agpkl

SCOPe Domain Coordinates for d1ayla1:

Click to download the PDB-style file with coordinates for d1ayla1.
(The format of our PDB-style files is described here.)

Timeline for d1ayla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ayla2