SCOP 1.67: Domain d1aq2_2: 1aq2 4-227

Lineage for d1aq2_2 (1aq2 4-227)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)

6. Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)

7. Species Escherichia coli [TaxId:562] [68926] (6 PDB entries)

8. Domain d1aq2_2: 1aq2 4-227 [64717]
   Other proteins in same PDB: d1aq2_1
   complexed with atp, mg, mn, pyr

Details for d1aq2_2

PDB Entry: 1aq2, 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1aq2_2:

Sequence; same for both SEQRES and ATOM records:

>d1aq2_2 c.109.1.1 (4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

Timeline for d1aq2_2:

• d1aq2_2 first appeared in SCOP 1.59
  
• d1aq2_2 appears in SCOP 1.65
  
• d1aq2_2 appears in SCOP 1.69
  
• d1aq2_2 appears in the current release, SCOPe 2.08, called d1aq2a2