Lineage for d1aq2_2 (1aq2 4-227)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) 
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68925] (2 species) Species Escherichia coli [TaxId:562] [68926] (5 PDB entries) 
Domain d1aq2_2: 1aq2 4-227 [64717]
Other proteins in same PDB: d1aq2_1
Details for d1aq2_2
PDB Entry: 1aq2 (more details), 1.9 Å
PDB Description: phosphoenolpyruvate carboxykinase
SCOP Domain Sequences for d1aq2_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq2_2 c.109.1.1 (4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Escherichia coli}
nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg
SCOP Domain Coordinates for d1aq2_2:
Click to download the PDB-style file with coordinates for d1aq2_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aq2_2:
- d1aq2_2 is new in SCOP 1.59
- d1aq2_2 appears in SCOP 1.61
- d1aq2_2 appears in the current release, SCOPe 2.08, called d1aq2a2
View in 3D
