Lineage for d1aq2_1 (1aq2 228-540)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494403Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 494404Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 494405Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (2 proteins)
  6. 494414Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (3 species)
  7. 494415Species Escherichia coli [TaxId:562] [53798] (6 PDB entries)
  8. 494419Domain d1aq2_1: 1aq2 228-540 [64716]
    Other proteins in same PDB: d1aq2_2

Details for d1aq2_1

PDB Entry: 1aq2 (more details), 1.9 Å

PDB Description: phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1aq2_1:

Sequence, based on SEQRES records: (download)

>d1aq2_1 c.91.1.1 (228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

Sequence, based on observed residues (ATOM records): (download)

>d1aq2_1 c.91.1.1 (228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtiteptptfsacfg
aaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldna
etftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpag
aalvaagpkl

SCOP Domain Coordinates for d1aq2_1:

Click to download the PDB-style file with coordinates for d1aq2_1.
(The format of our PDB-style files is described here.)

Timeline for d1aq2_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aq2_2