Lineage for d1a8vb2 (1a8v B:48-118)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789287Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 1789288Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 1789291Domain d1a8vb2: 1a8v B:48-118 [64715]
    Other proteins in same PDB: d1a8va1, d1a8vb1
    complexed with cu

Details for d1a8vb2

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator
PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d1a8vb2:

Sequence, based on SEQRES records: (download)

>d1a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

Sequence, based on observed residues (ATOM records): (download)

>d1a8vb2 b.40.4.5 (B:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadagpddiyvspsqirrfnlrtgdtisgkirppkegeryf
allkvne

SCOPe Domain Coordinates for d1a8vb2:

Click to download the PDB-style file with coordinates for d1a8vb2.
(The format of our PDB-style files is described here.)

Timeline for d1a8vb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8vb1