Class a: All alpha proteins [46456] (258 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies) helix-extended loop-helix; parallel helices |
Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family) |
Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein) |
Protein Rho termination factor, N-terminal domain [68914] (1 species) |
Species Escherichia coli [TaxId:562] [50295] (9 PDB entries) |
Domain d1a8vb1: 1a8v B:-1-47 [64714] Other proteins in same PDB: d1a8va2, d1a8vb2 complexed with cu |
PDB Entry: 1a8v (more details), 2 Å
SCOP Domain Sequences for d1a8vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a8vb1 a.140.3.1 (B:-1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge
Timeline for d1a8vb1: