SCOP 1.73: Domain d1a8vb1: 1a8v B:-1-47

Lineage for d1a8vb1 (1a8v B:-1-47)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (5 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family)

5. Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)

6. Protein Rho termination factor, N-terminal domain [68914] (1 species)

7. Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)

8. Domain d1a8vb1: 1a8v B:-1-47 [64714]
   Other proteins in same PDB: d1a8va2, d1a8vb2
   complexed with cu

Details for d1a8vb1

PDB Entry: 1a8v, 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator

PDB Compounds: (B:) transcription termination factor rho

SCOP Domain Sequences for d1a8vb1:

Sequence; same for both SEQRES and ATOM records:

>d1a8vb1 a.140.3.1 (B:-1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

Timeline for d1a8vb1:

• d1a8vb1 first appeared in SCOP 1.59
  
• d1a8vb1 appears in SCOP 1.71
  
• d1a8vb1 appears in SCOP 1.75
  
• d1a8vb1 appears in the current release, SCOPe 2.08