SCOPe 2.05: Domain d1a63a2: 1a63 A:48-130

Lineage for d1a63a2 (1a63 A:48-130)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Rho termination factor, RNA-binding domain [68910] (1 species)

7. Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
   Uniprot P03002

8. Domain d1a63a2: 1a63 A:48-130 [64711]
   Other proteins in same PDB: d1a63a1

Details for d1a63a2

PDB Entry: 1a63

PDB Description: the nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures

PDB Compounds: (A:) rho

SCOPe Domain Sequences for d1a63a2:

Sequence; same for both SEQRES and ATOM records:

>d1a63a2 b.40.4.5 (A:48-130) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenarnk

Timeline for d1a63a2:

• d1a63a2 first appeared in SCOP 1.59, called d1a63_2
  
• d1a63a2 appears in SCOPe 2.04
  
• d1a63a2 appears in SCOPe 2.06
  
• d1a63a2 appears in the current release, SCOPe 2.08