Lineage for d1a63_2 (1a63 48-130)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
barrel, closed; n=5, S=8
Protein Rho termination factor, RNA-binding domain [68910] (1 species) Species Escherichia coli [TaxId:562] [68911] (8 PDB entries) 
Domain d1a63_2: 1a63 48-130 [64711]
Other proteins in same PDB: d1a63_1
Details for d1a63_2
PDB Entry: 1a63 (more details)
PDB Description: the nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures
SCOP Domain Sequences for d1a63_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a63_2 b.40.4.5 (48-130) Rho termination factor, RNA-binding domain {Escherichia coli}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvnevnfdkpenarnk
SCOP Domain Coordinates for d1a63_2:
Click to download the PDB-style file with coordinates for d1a63_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a63_2:
- d1a63_2 first appeared in SCOP 1.59
- d1a63_2 appears in SCOP 1.69
- d1a63_2 is called d1a63a2 in SCOP 1.73
- d1a63_2 appears in the current release, SCOPe 2.08, called d1a63a2
View in 3D
