SCOP 1.61: Domain d1a62_1: 1a62 1-47

Lineage for d1a62_1 (1a62 1-47)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)

4. Superfamily a.140.3: Rho termination factor, N-terminal domain [68912] (1 family)

5. Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)

6. Protein Rho termination factor, N-terminal domain [68914] (1 species)

7. Species Escherichia coli [TaxId:562] [50295] (4 PDB entries)

8. Domain d1a62_1: 1a62 1-47 [64708]
   Other proteins in same PDB: d1a62_2

Details for d1a62_1

PDB Entry: 1a62, 1.55 Å

PDB Description: crystal structure of the rna-binding domain of the transcriptional terminator protein rho

SCOP Domain Sequences for d1a62_1:

Sequence; same for both SEQRES and ATOM records:

>d1a62_1 a.140.3.1 (1-47) Rho termination factor, N-terminal domain {Escherichia coli}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

Timeline for d1a62_1:

• d1a62_1 first appeared in SCOP 1.59
  
• d1a62_1 appears in SCOP 1.63
  
• d1a62_1 appears in the current release, SCOPe 2.08, called d1a62a1