SCOP 1.57: Domain d4otbg_: 4otb G:

Lineage for d4otbg_ (4otb G:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)

4. Superfamily d.80.1: Tautomerase/MIF [55331] (3 families)

5. Family d.80.1.1: 4-oxalocrotonate tautomerase [55332] (1 protein)

6. Protein 4-oxalocrotonate tautomerase [55333] (2 species)

7. Species Pseudomonas putida, XylH [TaxId:303] [55335] (4 PDB entries)

8. Domain d4otbg_: 4otb G: [63364]

Details for d4otbg_

PDB Entry: 4otb, 2.5 Å

PDB Description: 4-oxalocrotonate tautomerase observed as an octodecamer, rhombohedral crystal form

SCOP Domain Sequences for d4otbg_:

Sequence; same for both SEQRES and ATOM records:

>d4otbg_ d.80.1.1 (G:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH}
piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelask

Timeline for d4otbg_:

• d4otbg_ is new in SCOP 1.57
  
• d4otbg_ appears in SCOP 1.59
  
• d4otbg_ appears in the current release, SCOPe 2.08