Lineage for d4otan_ (4ota N:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81513Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 81514Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 81515Family d.80.1.1: 4-oxalocrotonate tautomerase [55332] (1 protein)
  6. 81516Protein 4-oxalocrotonate tautomerase [55333] (2 species)
  7. 81517Species Pseudomonas putida, XylH [TaxId:303] [55335] (4 PDB entries)
  8. 81557Domain d4otan_: 4ota N: [63353]

Details for d4otan_

PDB Entry: 4ota (more details), 2.75 Å

PDB Description: 4-oxalocrotonate tautomerase observed as an octodecamer, orthorhombic crystal form

SCOP Domain Sequences for d4otan_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4otan_ d.80.1.1 (N:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH}
piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelask

SCOP Domain Coordinates for d4otan_:

Click to download the PDB-style file with coordinates for d4otan_.
(The format of our PDB-style files is described here.)

Timeline for d4otan_: