Lineage for d4otae_ (4ota E:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330948Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 330949Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 330950Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (2 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 330951Protein 4-oxalocrotonate tautomerase [55333] (2 species)
  7. 330952Species Pseudomonas putida, XylH [TaxId:303] [55335] (4 PDB entries)
  8. 330983Domain d4otae_: 4ota E: [63344]

Details for d4otae_

PDB Entry: 4ota (more details), 2.75 Å

PDB Description: 4-oxalocrotonate tautomerase observed as an octodecamer, orthorhombic crystal form

SCOP Domain Sequences for d4otae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4otae_ d.80.1.1 (E:) 4-oxalocrotonate tautomerase {Pseudomonas putida, XylH}
piaqihilegrsdeqketlirevseaisrsldapltsvrviitemakghfgiggelaskv

SCOP Domain Coordinates for d4otae_:

Click to download the PDB-style file with coordinates for d4otae_.
(The format of our PDB-style files is described here.)

Timeline for d4otae_: