Lineage for d3tgki_ (3tgk I:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428534Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 428535Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 428536Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 428573Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 428574Species Cow (Bos taurus) [TaxId:9913] [57365] (66 PDB entries)
  8. 428591Domain d3tgki_: 3tgk I: [63339]
    Other proteins in same PDB: d3tgke_
    complexed with ca, so4; mutant

Details for d3tgki_

PDB Entry: 3tgk (more details), 1.7 Å

PDB Description: trypsinogen mutant d194n and deletion of ile 16-val 17 complexed with bovine pancreatic trypsin inhibitor (bpti)

SCOP Domain Sequences for d3tgki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgki_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d3tgki_:

Click to download the PDB-style file with coordinates for d3tgki_.
(The format of our PDB-style files is described here.)

Timeline for d3tgki_:

428591
d3tgki_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3tgke_